PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN538757.1_FGP014
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GATA
Protein Properties Length: 309aa    MW: 34789.3 Da    PI: 7.1769
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN538757.1_FGP014genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.47e-17239273135
               GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                        C++C + kTp+WR gp g+ktLCnaCG+++++ +l
  KN538757.1_FGP014 239 CTHCLSYKTPQWRTGPLGPKTLCNACGVRFKSGRL 273
                        *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004010.016154203IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.106.0E-4158195IPR013088Zinc finger, NHR/GATA-type
SMARTSM004012.0E-14233287IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.108233269IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-13237296No hitNo description
Gene3DG3DSA:3.30.50.101.0E-12238271IPR013088Zinc finger, NHR/GATA-type
CDDcd002023.90E-12238295No hitNo description
PfamPF003201.3E-14239273IPR000679Zinc finger, GATA-type
PROSITE patternPS003440239264IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MDVHPPNAAA SSLEELFPHQ PATESDRSGI EWLSVYVEDC LSTSASCTNP VSEELPPITM  60
ASQGAAKPKL PPRSSSNARK KKRSLASVIS DTDDQHCITL FVEPPLLLLD HKDWLAESEL  120
ILPKKDKDEE LVQEQEQEEE ENYKMSAGMQ FQQEQLVITC SYCLSSQSPQ WWDGPSGPTC  180
DACRLRIEAR NGHTTSSKKC YGQEIDKEQD IGKRRDKKKI KKAVYVNDEL LSEEPVKRCT  240
HCLSYKTPQW RTGPLGPKTL CNACGVRFKS GRLLPEYRPA NSPTFVSDIH SNSHKKVMQL  300
RNSVPHPRK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1213221RRDKKKIKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00415DAPTransfer from AT3G60530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1014210.0AK101421.1 Oryza sativa Japonica Group cDNA clone:J033038C04, full insert sequence.
GenBankEU8470160.0EU847016.1 Oryza sativa Japonica Group clone KCS030C12 GATA zinc finger protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618342.10.0PREDICTED: uncharacterized protein LOC4352838
TrEMBLA0A0E0JCN70.0A0A0E0JCN7_ORYNI; Uncharacterized protein
TrEMBLA0A0E0RK950.0A0A0E0RK95_ORYRU; Uncharacterized protein
TrEMBLA2ZMY10.0A2ZMY1_ORYSI; Putative uncharacterized protein
TrEMBLI1R8130.0I1R813_ORYGL; Uncharacterized protein
TrEMBLQ2QLX60.0Q2QLX6_ORYSJ; GATA zinc finger family protein, expressed
STRINGBGIOSGA037833-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os12g42970.10.0(Oryza sativa Japonica Group)
STRINGORGLA12G0166900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP59623656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.11e-35GATA transcription factor 4